PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G027600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 292aa    MW: 31869.4 Da    PI: 5.8979
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G027600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-172269148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+eEd ll+ +v+ +G g+W+  a + g++Rt+k+c++rw++yl
  Sevir.5G027600.1.p 22 RGPWTAEEDALLAGYVAAHGEGRWNELALEAGLRRTGKSCRLRWLNYL 69
                        89********************************************97 PP

2Myb_DNA-binding48.61.8e-1575118146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg +T+ E++l++d++ ++G++ W++Ia+ ++ gRt++++k++w++
  Sevir.5G027600.1.p  75 RGGFTPREQLLILDLHSRWGNR-WSKIAANLP-GRTDNEVKNYWRT 118
                         788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.021773IPR017930Myb domain
SuperFamilySSF466897.86E-3020116IPR009057Homeodomain-like
SMARTSM007171.1E-132171IPR001005SANT/Myb domain
PfamPF002494.9E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-212376IPR009057Homeodomain-like
CDDcd001675.96E-112469No hitNo description
SMARTSM007179.9E-1474122IPR001005SANT/Myb domain
PROSITE profilePS5129416.52174124IPR017930Myb domain
PfamPF002493.5E-1475118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2277123IPR009057Homeodomain-like
CDDcd001673.27E-1178118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEALWSMSPC GGLPSSAAEL RRGPWTAEED ALLAGYVAAH GEGRWNELAL EAGLRRTGKS  60
CRLRWLNYLR PGVRRGGFTP REQLLILDLH SRWGNRWSKI AANLPGRTDN EVKNYWRTRV  120
QKHAKQLGCD VGSARFHDAM RNLWMPRLLE RIHADELAAS ADVPHCYYSA PSSSQPACQN  180
AVAPISSSCA RAPSPDATSC VTGGSSSSWE AAQFQASSPT MAAWSTPEQC QNGCSSATTG  240
DNSMFDESWS ELLARANHDD ADSAGLLPDF GLGETGDNWW SLDDILQQPL Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241911624120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9733871e-150EU973387.1 Zea mays clone 397963 cpm7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967585.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLK3XKM30.0K3XKM3_SETIT; Uncharacterized protein
STRINGSi002446m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-72myb domain protein 112